Product Name :
Anti-h Inhibin beta A 9504 SPTN-5 | Medix Biochemica
Form :
Liquid, may turn slightly opaque during storage
Host Species :
Application :
FIA
Matched Pairs :
Product Overview :
| Product Name： Anti-h Inhibin beta A 9504 SPTN-5 | Catalog Number： 100709 | Description： Monoclonal mouse antibody, cultured in vitro under conditions free from animal-derived components. | Application： FIA
Further Specification :
| Form/Appearance： Liquid, may turn slightly opaque during storage | Concentration： 5.0 mg/ml (+/- 10 %) | Isotype： IgG1 | Clonality： Monoclonal | Epitope： Amino acids 81-112 (CVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE) | Purity： ≥ 95 % | Affinity constant： N/D | Buffer： 50 mM Na-citrate, pH 6.0, 0.9 % NaCI, 0.095 % NaN3 as a preservative | IEF Profile： 7.1–8.5 | Cross Reactivity： N/D | Specificity： Antibody recognizes human inhibin beta A subunit, also known as activin beta A
Storage and Shipping :
| Storage： +2-8°C | Shipping： Cold packs | Shelf Life： 12 months
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
JAK1 Rabbit mAb Autophagy
Phospho-YAP1 (Ser127) Rabbit mAb In Vivo
Cleaved-Caspase 8 Antibody: Cleaved-Caspase 8 Antibody is a non-conjugated and Mouse origined monoclonal antibody about 55 kDa, targeting to Cleaved-Caspase 8. It can be used for WB,IHC-F,IHC-P,ICC/IF assays with tag free, in the background of Human, Mouse, Rat.